SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035281 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035281
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.68e-76
Family Motor proteins 0.0000131
Further Details:      
 
Domain Number 2 Region: 1177-1493
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.41e-56
Family WD40-repeat 0.00018
Further Details:      
 
Domain Number 3 Region: 825-940
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000136
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035281   Gene: ENSMODG00000018544   Transcript: ENSMODT00000036869
Sequence length 1515
Comment pep:novel chromosome:BROADO5:8:124271044:124372734:1 gene:ENSMODG00000018544 transcript:ENSMODT00000036869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRNVNTESEMMQCLKLGAL
SRTTASTQMNVQSSRSHAIFTIHLCQTRVCPKIDAENTVDNKMTSESPEMNEYETLTAKF
HFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRATHVPYRDSKLTR
LLQDSLGGNSQTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQDRASQQINALR
SEITRLQMELMEYKTGKRIIDEEGVESINDMFHENAMLQTENNNLRVRIKAMQETVDALR
TRITQLVSDQANQVLARAGEGNEEISNMIHNYIKEIEDLRAKLLESEAMNENLRRNLTRA
TARSPYFSGSSAFSPSILSSEKETIEIIDMAKKDLEKLKRKEKKKKKRLQKLEESNQEEK
SVVKEDNTDTEQERKEEKVISERENNEIEIILSLRKLVYEGQYWDTGESSDESDSESDEK
ANYQEDLAHITCEIAIKQKLIDELENSQRRLQTLKKQYEEKLMMLQHKIRDTQLERDQVL
QNLGSVESCSEEKAKKVRSEYEKKLQTMNKELQRLQTAQKEHARLLKNQSQYEKQLKKLQ
QDVMEMKKTKVRLMKQMKEEQEKARMTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQE
VVLRRKTEEVTALRRQVRPMSDKVAGKVVRKLSSPDVPVQDSGSNITSVDSDSARGGIQQ
KMKIPVARVQALPIVPVNGTRKKYQRKGITGRVFTSKTARMKWQLLERRVTDIIMQRMTI
SNMEADMNRLLKQREELTKRREKLSKRKEKLTKENGDSDRNVLNINEEMESLTANIDYIN
DSISDCQANIMQMEEAKEEGETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEA
QIKVLEGRLKQTEITSATQNQLLFHMLKEKAELNPELDALLGHALQDLDSISLENVEDST
DEEAPLNSPGIEGSSLSSDLMKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDA
ILSGPLTPVAEGQEIGMNTETSGTSARDKELITPSGLPSKIGSISRQSSVPEKKIPEPSP
LTKRKAFERAEKSKTKEQKHSDSGTSEASLSPPSSPPSRPRNELNVFSRLTVSQGNTSVQ
QDKSDDSDSSLSEVHRQSSRMGIINPFPASKSIRSSPLQCIHIAEGHTKAVLCIDSTDDL
LFTGSKDRTCKVWNLVTGQEIMSLGGHPNNVVSVKYCNYTSLVFTISTSYIKVWDIRDSA
KCIRTLTSSGQVMPGDACNTSTNRTVTIPSGENQINQIALNPNGTFLYAASGNAVRMWDL
KRFQSTGKLTGHLGPVMCLTVDQISNGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFE
PPHYDGIEALTIQGDNLFSGSRDNGIKKWDLSQKDLLQQVPNAHKDWVCALGMVPGQPAL
LSGCRGGILKLWNVDTFAPVGEMKGHDSPINAICVNTTQIFTAADDHTVRIWKARNLQDG
QISDIGDLNEDIAFN
Download sequence
Identical sequences F6ZQH8
ENSMODP00000035281 ENSMODP00000035281 13616.ENSMODP00000035281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]