SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035299 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035299
Domain Number 1 Region: 822-1129
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000948
Further Details:      
 
Domain Number 2 Region: 1086-1388
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-83
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000856
Further Details:      
 
Domain Number 3 Region: 321-515
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-28
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 2-121
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-27
Family MAM domain 0.00000061
Further Details:      
 
Domain Number 5 Region: 219-351
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000568
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 6 Region: 128-226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000418
Family I set domains 0.0000346
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035299
Domain Number - Region: 534-571,624-671
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0573
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035299   Gene: ENSMODG00000021453   Transcript: ENSMODT00000036886
Sequence length 1390
Comment pep:novel chromosome:BROADO5:3:274542947:275340320:1 gene:ENSMODG00000021453 transcript:ENSMODT00000036886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGSFMLVNTSGRPELQRTHLLLPQLKENDTHCIDFHYFVSSKSHSLPGLLNVYVKVNN
GPLGNPIWNISGAPTGTWNRAELAISTFWPNFYQVIFEVVTSGHYGYLAIDEVKVLGHPC
TKTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSPRRFI
ASFSVVNTTKQDAGNYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWIQL
NANSINGDGPIIGREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGG
TGSPGPALRTRTKCADPMRGPRKLEVVEIKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQ
VGGQEQVREEVSWDTDNSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDEDLP
SSVPIESIQGSTFEEKIFLQWREPAQTYGVITFYEITYKAVSSFDPEIDLSNQSGRVSKL
GNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQTDN
TVTVLLKPAQSRGAPVSVYQIVVEEESPRRTKKTTEILKCYPVPIHFQNASILNSPYYFA
AEFPANSLQAAQPFTIGDNRTYNGYWNSPLLPHKSYRIYFQAASRANGETKIDCVRVATK
GAATPKPAPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSSTRQ
EMTVMVNSMDKSYAEQGTNCDEAFSFMDTHNLNGRSVSSPSSFTMKTNTLSTTVPNSYYP
DETHTMASDTSSLVQSHTYKKRENADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKE
EYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQTLEGDTNSDYINGNYIDGY
HRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDI
KVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVKS
KSPPNAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEE
QYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTLRV
EDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVTQH
PLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEED
IISRIFRIYNASRPQDGYRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVEKWQEEYNGGE
GRTVVHCLNGGGRSGTFCAISIVCEMLRHRRAVDVFHAVKTLRNNKPNMVDLLDQYKFCY
EVALEYLNSG
Download sequence
Identical sequences F6ZQ35
ENSMODP00000035299 ENSMODP00000035299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]