SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035307 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035307
Domain Number 1 Region: 277-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-49
Family SPRY domain 0.0000627
Further Details:      
 
Domain Number 2 Region: 3-82
Classification Level Classification E-value
Superfamily RING/U-box 7.78e-27
Family RING finger domain, C3HC4 0.0053
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000102
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035307   Gene: ENSMODG00000024714   Transcript: ENSMODT00000036894
Sequence length 462
Comment pep:novel chromosome:BROADO5:1:121276343:121277728:1 gene:ENSMODG00000024714 transcript:ENSMODT00000036894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSSPREMDVSEMTEKLSSELTCSICLDLFTQPVTLDCGHSFCRECVLRSWQEAQVPWTCP
LCRASSRPRALESTRVLEDLTSISRQLRLPGDMCGQHQAVQKLFCEDDFSPLCVSCLLPQ
EHEGHRVYPLEESAETCKGQLQEALGQARAKVREAHVLLEQERARRLRCRSEAATLKRVI
LPEYIKTHLVWTEKEQQDLLNKEKRRNMNRLRASEARISRYVQSLEKMTEELQETLEQPL
VEMLLAGRSTLQRSRELLLCCPEPAALCWTLCGITGMRELLLVFQSHISLDPRTAHSSLI
LSEDLKSVRLAFHWRDLLANLQGEAECPLIVLGAQSFTSGRHYWEVEVGSKMEWEVGICR
EPGNDQGSIHGGVLSLAHLKMRNQFNLWLSHTMGNPDDTGPLHRLGIFLHYEEGHLSFYN
VTQGCLIYAFPPVTFQGPLRPFFSPGLIHEDNQPSSVTICPL
Download sequence
Identical sequences F7FC16
ENSMODP00000035307 ENSMODP00000035307 13616.ENSMODP00000035307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]