SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035340 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035340
Domain Number 1 Region: 34-140
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.24e-35
Family WD40-repeat 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035340   Gene: ENSMODG00000024728   Transcript: ENSMODT00000036928
Sequence length 140
Comment pep:novel chromosome:BROADO5:3:270695907:270701233:-1 gene:ENSMODG00000024728 transcript:ENSMODT00000036928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEEEKKPEAEATKTQSTPSSSTNQSKPAPVKPNYALKFTLAGHTKSVSSVKFSPNGEW
LTSSSADKLIKIWGAYDGKFEKTVSGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSG
KCLKTLKGRSNYVFCCNFNP
Download sequence
Identical sequences F7EFC6
ENSMODP00000035340 13616.ENSMODP00000035340 ENSMODP00000035340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]