SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035487 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035487
Domain Number 1 Region: 1057-1107
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.0000000000000262
Family Eferin C-derminal domain-like 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035487
Domain Number - Region: 510-612
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000102
Family Myosin rod fragments 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035487   Gene: ENSMODG00000018407   Transcript: ENSMODT00000037073
Sequence length 1117
Comment pep:novel chromosome:BROADO5:8:117976964:118302650:1 gene:ENSMODG00000018407 transcript:ENSMODT00000037073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGSARSVGKVEPSSQSPGRSPRLPRSPRLGHRRTNSTGGSSGSSTGGGSGKTLSMENIQ
SLNAAYATSGPMYLSDHENMGPDTPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVAS
DTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLS
SSMNSIKTFWSPELKKERALRKDEASKITVWKEQYRVVQEENQHMQMTIQALQDELRIQR
DLNQLFQQDGSNRANEPFAAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQ
TLSARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLLEQKEKENNML
REEMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSTEERE
EEMKQMEVYRSHSKFMKNKVEQLKEELSAKETQGEELKKRAAGLQTEIGQVKQELSRKDT
ELLALQTKLGTLTKSFSDRQMYFKLIVKSKKVKENLLNTVDALRLRLEEKETMLNKKTKQ
IQEIVEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSNLKERVKSL
QADTTNTDTALTTLEEALSEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKVSLL
QGDLSEKEEVQLLSRLLHTLLKFFSQLLDELNSDNLYYFCRSNFIIIIRFKFNMEKAHEA
TIEARGSPEMNDRIQQLEKEIIQHRDESSKSQAEVDRLLEILKEMENEKNDKDKKIAELE
SLTSRQIKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDNLRKKDDRI
EELEEALRESVQITAEREMVLAQEESARTFAEKQVEELMMAMEKVKQELESMKAKLISTQ
QSLAEKETHLTNLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKKTQDEVA
ALKREKDRLVQQLKQQTQNRMKLMADNYEDDHFKSSHSSQTNHKPSPDQIIQPLLELDQN
RSKLKLYIGHLTSLCHDRDPLILRGLSPPASYHLDDDRAAWESELQKMTQEQLCSELEKG
ERDNAELQEFANAILQQIADHCPDILEQVVNALEESS
Download sequence
Identical sequences F7GK59
ENSMODP00000035487 ENSMODP00000035487 13616.ENSMODP00000035487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]