SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035560 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000035560
Domain Number - Region: 6-75
Classification Level Classification E-value
Superfamily DEATH domain 0.0212
Family Caspase recruitment domain, CARD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035560   Gene: ENSMODG00000024775   Transcript: ENSMODT00000037147
Sequence length 98
Comment pep:novel chromosome:BROADO5:6:110684217:110684510:-1 gene:ENSMODG00000024775 transcript:ENSMODT00000037147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQFQAILPQVRALLSSAWPAQVRRFLDGLLEKDLLSKEYHQALLRESDGEALARKVSLS
LLEKWDLCIGTLIQCVGCSGNKLQTPGMDGVSLSKSRG
Download sequence
Identical sequences F7C7F0
ENSMODP00000035560 13616.ENSMODP00000035560 ENSMODP00000035560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]