SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035682 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035682
Domain Number 1 Region: 57-849
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.74e-289
Family Motor proteins 2.82e-17
Further Details:      
 
Domain Number 2 Region: 970-1086
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.5e-25
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 3 Region: 850-975
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.23e-24
Family Myosin rod fragments 0.00014
Further Details:      
 
Domain Number 4 Region: 1248-1362
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.92e-20
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 5 Region: 1528-1641
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000111
Family Myosin rod fragments 0.0015
Further Details:      
 
Domain Number 6 Region: 1364-1464
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000837
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number 7 Region: 1078-1164
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000034
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number 8 Region: 31-64
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0000942
Family Myosin S1 fragment, N-terminal domain 0.00084
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035682
Domain Number - Region: 1642-1758
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00209
Family Myosin rod fragments 0.012
Further Details:      
 
Domain Number - Region: 1735-1932
Classification Level Classification E-value
Superfamily Tropomyosin 0.0034
Family Tropomyosin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035682   Gene: ENSMODG00000004360   Transcript: ENSMODT00000037268
Sequence length 1943
Comment pep:novel chromosome:BROADO5:6:104273189:104409252:1 gene:ENSMODG00000004360 transcript:ENSMODT00000037268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGQLSDDEKFLFVDKNFINSPVAQADWTAKKLVWVPSEKQGFEAASIKEEKGDEVIV
ELAENGKKITVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVVNPYKYLPIYSEKIIDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFAYGELEKQLLQANPILEAFGNAKT
VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKE
QMKNDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETLEAMGIMGFSEEEQLAMLKVVSSV
LQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRAILTPRIKVGRDVVQKAQT
KEQADFAIEALAKATYERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQ
LCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLA
LLDEECWFPKATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLT
KNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTV
GQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQ
GFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTG
VLAHLEEERDLKITDVIMAFQAMSRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQ
WWRLFTKVKPLLQVTRQEEEMQAKEDELQKIKEKQQKAESELKELEQKHTQLAEEKNLLQ
EQLQAETELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAEKKKMAQQML
DLEEQLEEEEAARQKLQLEKVTAEAKIKKMEDDILVMDDQNNKLTKERKLLEERISDLTT
NLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKMKRKLEGDASDFHEQIAD
LQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAA
RNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEEIRTHEAQ
VQEMRQKHTQAVEELTEQLEQFKRAKANLDKNKQTLEKDNADLANELRSLNQAKQEVEHK
KKKLEAQVQELQSKCSDGERVRAELNDKVHKLQNEVESVTGMLNEAEGKTIKLAKDVASL
GSQLQDTQELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEVEAKQNLERHISTLNIQL
SDSKKKLQDFASTVEGLEEGKKKLQKEIEGLTQQYEEKAASYDKLEKTKNRLQQELDDLV
VDLDNQRQLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALE
EALESKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELED
ELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQKQLHEYETELEDERKQRA
LAAAAKKKLEVDIKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASREEIFA
TAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKDELTEELASSVSGRNALQDDKRR
LEARIAQLEEELEEEQGNMEAMSDRFRKATQQAEQLNNELAAERSTAQKNESARQQLERQ
NKELKSKLQEMEGAVKSKFKATIAALESKIAQLEEQVEQEAREKQAATKTLRQKDKKLKE
VMLQVEDERKLAEQYKEQAEKGNTRVKQLKRQLEEAEEESQRINANRRKLQRELDEATES
NEAMGREVNALKSKLRGPQEPSQ
Download sequence
Identical sequences F7FAW0
ENSMODP00000035682 ENSMODP00000035682 XP_007498669.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]