SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035924 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035924
Domain Number 1 Region: 9-404
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.96e-117
Family Motor proteins 0.000000996
Further Details:      
 
Domain Number 2 Region: 1300-1614
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.71e-57
Family WD40-repeat 0.0000946
Further Details:      
 
Domain Number 3 Region: 974-1096
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000706
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035924   Gene: ENSMODG00000000144   Transcript: ENSMODT00000037512
Sequence length 1646
Comment pep:novel chromosome:BROADO5:2:104366786:104438261:-1 gene:ENSMODG00000000144 transcript:ENSMODT00000037512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQGDCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQ
EQIYTACVGKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDINTSEEEHGIIPRAIAHL
FRGIAQRKRQAQEQGVPGPEFKVSAQFLELYNEEILDLFDSTRDLDSRHRKSNIKIHEDA
NGGIYTTGVTSRLINSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRVCA
QPELVNDEVPGLTDGTAPTNEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGL
LALGNVISALGDQSKKAVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNT
LKYANRARNIKNKVIVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGSEGYSDL
YRENAMLQKENGTLRMRVKAMQEAIDAINNRVTHLMSQEASLLLAKAGDGNEAIGTLIQN
YIREIEELRTKLLESEAMNESLRRTLSRSAMRPPYSTSNPTPQTQGGYMSSPSTSMETEA
FEVIRKAKQDLERLKKKETRQRRKSPEKEAFKKRAKLHQENGEETDENEAEEEEEDRDES
GCEEEEGREDEDEDSGSEESVVDSDSDPEEKEVNFQADLADLTCEIEIKQKLIDELENSQ
RRLQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIRADYEKRLREM
NRDLQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLIE
TKRNREIAQLKKEQRRQEFQIRALESQKRQQEIVLRRKTQEVSALRRLTKPMSERAAGRV
GMKPPMMDSGAEISASTTSSEAESGARSVSSIVRQWNRKINHFLGDPATPVNGTRPARKK
FQKKGVSQTFSKAARLKWQSLERRIIDIVMQRMTIINLEADMERLIKKREELFLLQETLR
RKKEKLQEESPEEEKGLQELSEEIEVLAANIDYINDSISDCQATIVQLEETKEELDSTDT
SVVISSCSLAEARLLLDNFLKASIEKGLQVAQKEAQIRLLEGRLRQTDMNNSSQNHLILD
ALREKAETHPELQALIHNVQQENGYATTDQEISFSEGSFSQSFTMKGSTSHDDFKFKGEP
KLSAQMKAVSAECLGPPLDISTKNITKSLASLVEIKEDGVGFSIRDPYYRDKVSRTISLP
TRGSTFPRQSRGSDTSPVTRRKSYDRGQPIRSSDMAFTPPSSPPTRPRNDRNVFSRLTSN
QSQGSALDKSDDSDSSISEVLRGIISPIGGAKSARTAPLQCVSVAEGHTKPILCLDATDE
LLFTGSKDRSCKMWNLVTGQEIASLKGHPNNVVSIKYCGHLGLVFSVSTSYIKVWDIRDS
AKCIRTLTSSGQVISGDACASTTNRTITSAQGEHQINQIALNPTGTILYAASGNSVRVWE
LNRFQPIGKLTGHIGPVMCLTVNQTSNHHDLVVTGSKDHYVKMFELAESIMGNISPTHNF
EPPHYDGIECLAIQGDVLFSGSRDNGIKKWDLEQQELIQQIPNAHKDWVCALAFVPGRPM
LLSACRGGFIKVWNVENFTPIGEIKGHDSPINAICTNSKHIFTASSDCRVKLWSYVPGLT
PCLPRRVLAIKGRATSLPPLLSSLFP
Download sequence
Identical sequences F7A9R7
ENSMODP00000035924 13616.ENSMODP00000035924 ENSMODP00000035924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]