SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036164 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036164
Domain Number 1 Region: 1377-1847
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.8e-163
Family Family 1 of glycosyl hydrolase 0.0000000104
Further Details:      
 
Domain Number 2 Region: 903-1364
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.81e-158
Family Family 1 of glycosyl hydrolase 0.00000000346
Further Details:      
 
Domain Number 3 Region: 386-848
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.81e-122
Family Family 1 of glycosyl hydrolase 0.0000000733
Further Details:      
 
Domain Number 4 Region: 73-260
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-27
Family Family 1 of glycosyl hydrolase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036164   Gene: ENSMODG00000000972   Transcript: ENSMODT00000037753
Sequence length 1925
Comment pep:novel chromosome:BROADO5:4:132783944:132831103:-1 gene:ENSMODG00000000972 transcript:ENSMODT00000037753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAWHIAFVLLSSVPCWGLDGESTRNFIIVAGPFPSDLVQDSNHSLSEPGSNLIASSLD
ADICSQPSIGTLSRYFGRLHASGVTHYKIFLPWVRLLPTGNSKEPAESTVQCYRRLLEAL
QAAQLQAVVILHHGTFPRQAWASPRGAWSSDLFPGLFADYALFAFHSFGDLVDIWLTFSD
LGAAMEDLPPQESRSTRLRAIIGAHRKAYDVYHEKLASLGGKVSVVLKVEEISEYLLGSS
QYPLIKDSIDFLSLDLLSDCQSEAGPPQELSGLQAVHPQVEVLIFRLQLQHCAPSREKSA
RLLFDTLEAINKDQVLTIGFDVNEFLECPSGAKERGSLFSQDTLARREQSRGAAVSGTLT
SAYRTVWQRFANQSEAERDSFLRDVFPRGFLWGASTGAFHVEGAWAEDGKGETIWDRFGR
RGLAENGAAPDVASDSYHKVQHDVALLRGLRAQVYKFSISWSRIFPTGYKSSVNPRGVAY
YNKLIDSLLDSHIQPMATLFHWDLPQALQDHGGWQNGSVVDAFVDYAAFCFAAFGDRVKL
WVTFHEPWVISHAGYGTGRHAPGISDPGGASFKVAHSILKAHAKAWHHYSRHHRPKQQGK
VGIVLNADWAEPFSPEEMADVEAAERYLHSMLGWFAHPLFVDGDYPATLRAQIQLKNRQC
AGVVAQIPPISEEEKLLLRGSSDFLGLSHYTSRRIRDAQDSCAPGYDRLRGFSQHVDPAW
PQTSSPWLQVVPWGLRRLLSFVSLEYTKGDVPIYLAGHGLPVEAGSSFEDAARRDYFQLY
VNEVLKGAAEDVRMNRSYLCLPVRIDARVRACVTPEIWPTHVDSLDGSRPRTPRKSAYFF
SSLIEKNGFLTKKKDRASRLLYSPPPKIPVTLGPSEVPSKAKVVWEKFSSLPKFERDLFY
HGTFRDDFLWGVSSSAYQIEGGWDADGKGPSIWDNFTHTPGNNVVNNDNGDIACDSYNKL
EEDLNILRALRVKAYRFSLSWSRIFPTGRIDSVNKYGVDYYNRLIDGLVASSIIPMVTLY
HWDLPQALQDIGGWDNPSLIELFDSYADFCFRTFGDRVQFWMTFNEPMYEAWLGYGEGVF
PPGVKDPGYAPYRIAHTIIKAHARVYHTYDEKYRESQKGVISLSLSTHWMEPKSPNLPGD
IEAADRALQFSLGWFAHPIFRNGDYPDAMKWKVGNRSELQNLATSRLPSFTEEEKRYIRN
TADVFCLNTYSTKIVKHRTPQLNPPSYENDLERTEEDDNSWPSTAVNRAVPWGMRRVLNW
LKEEYGDIPIYVTENGVGLKKSQIEDIDRIFFFKTYINEALKAYNLDGVNLQGYMAWSMM
DNFEWLQGYSVKFGLYQVDFNDTNRPRTARTSARYYTEVINNNGMPLDKEDEFLYGEFPK
GFVWSAASAAYQIEGAWRADGKGLSIWDTYSHTPLRIENDDTADIACDSYHKIQEDVVAL
QNLGVSHYRFSISWTRILPDGTTRQINEKGLNYYERLIDALLAASIMPQVTLYHWDLPQA
LQNVGGWENDTIVQRFKEYADVLFRRLGDKVKFWITLNEPYVIANLGHGYGTAAPGISFR
PGTAPYIVGHNLLKAHAEAWHLYNDVYRAKQGGLISITISSDWAEPRDPSKQEDVEAARR
YVQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLSKSRLPEFTEEEKRRINGTFDFFG
FNHYTTILASNLDYPNYISSYDADRGVASIADRSWSDSGSFWLKITPFGFRRILKWLKEE
YGNPPIYITENGVSERGTSSLNDTIRIYYLRSYINEVLKAIQDNVDIRGYTVWSLMDNFE
WATGFTERFGLHFTNYTDPSIPRIPKESVKYYASVVRCNGFPDPAHGPHPCLQSEDVLPT
IESVTDRQVQFLGLTLDATNAETALYILFLLLIVGVCGLAFTLYKFCKVSKKSPRGTGQH
ELSQM
Download sequence
Identical sequences F6WCI6
ENSMODP00000036164 ENSMODP00000036164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]