SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036227 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036227
Domain Number 1 Region: 47-88
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000000118
Family BAFF receptor-like 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000036227
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00053
Family BAFF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036227   Gene: ENSMODG00000001449   Transcript: ENSMODT00000037816
Sequence length 274
Comment pep:novel chromosome:BROADO5:6:85059355:85112563:-1 gene:ENSMODG00000001449 transcript:ENSMODT00000037816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIVKPYLWWRTMKQCPEEHYWDFLLQKCTPCEYRCKRPNHQNCDMFCKSLRCKKQGSYY
DHLVKDCISCYSICGQHPKQCAHICQSKKLGPSKNLGSELRKQARVRAFTEGKELDRHKP
LKTQERGRVQACPLIPSLELSGDPGQLAVVYTVLGLCVCAAFCCFVITVACFLRRKGEQP
PPGRLQDFTEGGGSKELRTPEPVETCGFCFPEQTPPTEESAAPTEASRPEEENGVAPRGW
LGPVGTASSGPPPGCKEGCLNIICSPSQEKAPPS
Download sequence
Identical sequences F6SF82
ENSMODP00000036227 ENSMODP00000036227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]