SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036251 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036251
Domain Number 1 Region: 224-465
Classification Level Classification E-value
Superfamily Caspase-like 4.93e-76
Family Caspase catalytic domain 0.000000723
Further Details:      
 
Domain Number 2 Region: 8-125
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-30
Family DEATH effector domain, DED 0.0031
Further Details:      
 
Domain Number 3 Region: 101-178
Classification Level Classification E-value
Superfamily DEATH domain 4.94e-16
Family DEATH effector domain, DED 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036251   Gene: ENSMODG00000015106   Transcript: ENSMODT00000037841
Sequence length 472
Comment pep:novel chromosome:BROADO5:7:171489540:171525636:1 gene:ENSMODG00000015106 transcript:ENSMODT00000037841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDNSKIKFNQQLLSINEKLEPEEIEALKFLCSDLISPRNLEDIESGHQLFQKFMDEDLL
NEGDYFLVAELLFLIKHHNLLQKIGYTKEKVKKELSSKRKISSYRVMLYNLSEEITTEDF
EHIKFIMKEHIPKTLKTFLSLLRHMEKQNLLSENNLEILVNICKPLSINLIKRIEQYKSE
KGESESLSEQPITEEFLSKSQEEEKLNVASAITGTTSDEMEEAKFYRMDHSHRGHCIIFN
NFEFQTMKRRRGSCKDADELKSVFEWLGFTVKIHPNTEKREMEDILQQCSTSPEHRESDC
FVCCVLTHGESGSVFSSDEEKIAIRELTSYFKAHRCPGLANKPKLFFFQACQGPDIQESM
LLEEDAKISPPIQVETPQRYIPVEADFLLGMATVDGCCAIRHTIKGSWYIQALCHRLKCM
VPRNEDILTILTEVNNDVSQLTDAEGKKKQMPQPAFTLRKKVVFPVPPLSPP
Download sequence
Identical sequences F6RWK2
ENSMODP00000036251 ENSMODP00000036251 XP_007501670.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]