SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036356 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036356
Domain Number 1 Region: 24-216,297-456
Classification Level Classification E-value
Superfamily L domain-like 1.36e-60
Family Ngr ectodomain-like 0.0063
Further Details:      
 
Domain Number 2 Region: 1138-1327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.37e-44
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 549-688
Classification Level Classification E-value
Superfamily L domain-like 1.59e-36
Family Ngr ectodomain-like 0.00072
Further Details:      
 
Domain Number 4 Region: 747-886
Classification Level Classification E-value
Superfamily L domain-like 1.43e-33
Family Ngr ectodomain-like 0.0077
Further Details:      
 
Domain Number 5 Region: 994-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000184
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 6 Region: 1034-1152
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000565
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 912-951
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000583
Family EGF-type module 0.006
Further Details:      
 
Domain Number 8 Region: 953-997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 1409-1443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000305
Family EGF-type module 0.019
Further Details:      
 
Domain Number 10 Region: 1323-1363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000621
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000036356
Domain Number - Region: 1367-1402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000396
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036356   Gene: ENSMODG00000004492   Transcript: ENSMODT00000037946
Sequence length 1523
Comment pep:novel chromosome:BROADO5:1:74062268:74312009:1 gene:ENSMODG00000004492 transcript:ENSMODT00000037946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKHRAGHSAWLRPEVWLLVWNALCQLCARGCPALCTCTGTTVDCHGMGLRAVPKNIPR
NTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMRELERLRLNRNHL
HLLPELLFQNNQALSRLDLSENSIQAIPRKAFRGATDLKNLQLDKNQISCIEDGAFRALR
GLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPSIGLFTQ
CAGPASLRSLNVAEVQKNEFSCSGPGEATRAPVCTLSSGSCPPMCACSNGIVDCRGKGLT
AIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQISEIAPDAFQGLRSLNS
LVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCVRADAFQDLQNLSLLSLYDNKIQSLA
KGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQIK
SKKFRCSAKEQYFLPGTEDYQLNSECNSDAICPHKCRCESIVVECSNRKLNKERLNNNEI
SILEATGIFKKLPHLKKINLSNNKVAEIEDGAFEGAASVSELHLTVNQLESIRSGMFRGL
DGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQISTISPGAFDTLQSLSTLNLLANP
FNCNCQLAWLGDWLRRRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCEEGQEEGGCLPRP
QCPQECTCLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPAQLSTFRYLQLVDLS
NNKISSLSNSSFTNMSQLTTLILSYNSLQCIPPLAFEGLRSLRLLSLHGNDISTLREGIF
TDVTSLSHLAIGANPLYCNCHLRWLSSWVKTGYKEPGIARCAGPPDMEGKLLLTTPAKKF
ECQGPPSIAVQAKCNPCLSSPCQNQGSCQNDPLDSYRCACPSGYKGRDCEMSLNSCSSGP
CENGGTCHSGAGEGAGFTCSCPMGFEGPTCGVDTDDCRDHTCENGGICEDGINNYTCVCP
LQYTGRACEQLVDFCSQDLNPCQHGAKCVGTPEGPKCECAPGYIGDNCSINYDDCTHHQC
QNGARCVDEVNGYSCLCEEGYSGQLCEMASQLLKPLSPCEGAECQNGANCVDLGNRPVCQ
CLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVATAEDNGILLYNGDNDHI
AVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVTFDQMVNLSIDGGSPMTMDN
FGKHYTLNREAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNELQDFTKTQMK
PGVVPGCEPCRKLYCLHGICQPNAAQGPICHCEPGWGGPHCDQQLGHPCQGHKCVHGTCV
PLDALSYSCQCQDGYRGALCNQPGEPLDPCENLHCLHGHCQISSEGAARCVCRSGFAGEL
CEQARELESPFCQGDSVWDFHLVQSGYAICQTTRPACRGSCLGQGCCTGLRMKRRRFTFE
CSDGSSFVEDVEKTIKCGCAGCM
Download sequence
Identical sequences F6VQN3
ENSMODP00000005546 ENSMODP00000036356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]