SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036393 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036393
Domain Number 1 Region: 309-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-47
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily RING/U-box 2.1e-19
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 83-143
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000275
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036393   Gene: ENSMODG00000001670   Transcript: ENSMODT00000037983
Sequence length 492
Comment pep:novel chromosome:BROADO5:5:120633400:120638049:1 gene:ENSMODG00000001670 transcript:ENSMODT00000037983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENFKEELTCPVCLDYFSRPVTLGCGHNFCRLCLLKKWGEVDQPCPCPECRRSFLIRDFEI
NHRLSRLSKMARKIRPYLLQLKKESAVCERHQEEQKLFCKEDQTLLCVSCVQTQDHSKHT
VCPIEKAAEYSRDKLQKTLELLWKKVELIQNMLTEEREKMLTWNEQADAWRESTRIQYKR
FCEFLKYEEKWHLHLLKMDESKNMKNLRASEARLSQYLQNLKKVIIELEQNDQKTDLQLL
QVRLGKISKYSETIALFENTILTITPNDWGMGGVVNECPLCRIILFLPDSMGTVELIIHS
RFEVLKIMKLLGLFIENVTLDTESACPYLIVSEDMKTVTHGGFQKHIPTGPHQFEDSIIL
GAQIFTSGMHYWEVYVGDSWEWSVGVCKASLSRNTRIPFFYGDVFALTYFQKKNNYSIMT
TPLSVEHEFNSPIKKIGIFLDYDQGSISLYDAEKHSLIFHFPSFPFCEPLKAMFCPCPPL
AEERGIPMTINP
Download sequence
Identical sequences F6UC27
ENSMODP00000036393 13616.ENSMODP00000036393 ENSMODP00000036393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]