SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036422 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036422
Domain Number 1 Region: 1060-1280
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.22e-80
Family Fibrinogen C-terminal domain-like 0.00000177
Further Details:      
 
Domain Number 2 Region: 713-875
Classification Level Classification E-value
Superfamily Fibronectin type III 2.76e-22
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 3 Region: 888-1047
Classification Level Classification E-value
Superfamily Fibronectin type III 3.02e-21
Family Fibronectin type III 0.00068
Further Details:      
 
Domain Number 4 Region: 536-697
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-21
Family Fibronectin type III 0.00073
Further Details:      
 
Domain Number 5 Region: 445-531
Classification Level Classification E-value
Superfamily Fibronectin type III 1.84e-18
Family Fibronectin type III 0.00068
Further Details:      
 
Domain Number 6 Region: 358-444
Classification Level Classification E-value
Superfamily Fibronectin type III 8.13e-18
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 7 Region: 273-356
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000218
Family Fibronectin type III 0.00066
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000036422
Domain Number - Region: 209-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Integrin beta EGF-like domains 0.063
Further Details:      
 
Domain Number - Region: 147-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 177-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0356
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036422   Gene: ENSMODG00000004446   Transcript: ENSMODT00000038012
Sequence length 1295
Comment pep:novel chromosome:BROADO5:2:67404787:67475817:1 gene:ENSMODG00000004446 transcript:ENSMODT00000038012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNREQQVMFSHTYKIDVPKSSLIQVEADPQPLSDDGGRLLLPGEANEEQNIIFRHNIRLQ
TPKGDCEMSGSIQDLLARVKKLEEEMAEMKDKCGTQQCCQGAPGEYTTCLSNLCSGHGIF
TQDTCGCRCDEGWEGPDCSLPSCPAGCSGHGRCVDGRCICDEPYIGEDCGYLPCPENCSG
NGICVRGVCQCYEDFTSEDCSEKRCPNDCSGHGFCDTGECYCEEGFTGLDCSQILCISFC
SLIISLGRLPCIMGMEKVEDSKGKDMSVIGTAWVTDETENSLDVEWENPPTEVDYYKLRY
GSLQGQEVEEVTVPKSNDPKSRYDITGLQPGTEYKITVVPMKGGLEGKPISLNGMTGIDS
PTNVVTDRVTEDTAAVSWDPVQAPIDRYVVRYTSAEGEVKSTPVEKDKSSTVLTGLNPGM
EYTVHVWAEKGNQESKKANTKALTEIDSPTNLVTERVTEDTATISWDPVQAVIDRYLVRY
TSADGETKEIPVVKDKTTTLLTGLRPGMDYTVYVWAEKGNQESKKANTKAPTEIDDPKNL
ITNRVTEDTATISWDPVQAVIDKYMVRYSSADGETREIPVGKDETTTILTDLRPGVDYTV
YVWAVKGDRESKKANTKAPTEIDDPKNLITNRVTEDTATISWDPVQAVIDKYMVRYTSAD
GETREIPVGKDKTTTTLTGLRPGMDYTVHVWAVKGDRESKKANTKAPTEIDDPKNLITDR
VTEDTATISWNPVQAVIDKYMVRYTSADGETREIPVGKDKTTTTLTGLRPGVDYTVYVWA
VKGDRESKKVNTIAPTEIDSPRNLVTDQVTEKTATISWDPVQAVIDRYMVRYTSADGETK
EKPVGKDKTTTTLTGLRPGMEYTVYVWAVKGDQESKKANTRALTEIDDPKNLMTNQVTED
TAILSWDPVQAIIDRYMVRYTSVDGETKEIPVEKTKTATILTDLKPGMEYSVYVWAVKGD
QESKKANTKALTDIDPPRNLRASDVTQSSGVVTWMPPSAQIDGYILTYQAPDGTSKEVKL
GPWDQRFELQGLDLGVRYTISLVAFKGDRQSRSVSTNLSTVGARFPHPSDCSQVQQNGDV
GSGMYTIYLHGDVNQPMQVYCDMDTDGGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKE
FWFGLEKLHNLTTGTPVRYEVRVDLQTANESAYAVYDFFQVASSKDRYKLTVGKYRGTAG
DALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEP
WKGHEFSIPYVELKIRPHGFSGRHILGRKKRMITG
Download sequence
Identical sequences F6Y8C8
ENSMODP00000036422 ENSMODP00000036422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]