SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036608 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000036608
Domain Number - Region: 25-119
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.034
Family Myosin rod fragments 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036608   Gene: ENSMODG00000025025   Transcript: ENSMODT00000038201
Sequence length 123
Comment pep:novel chromosome:BROADO5:3:144651080:144651451:-1 gene:ENSMODG00000025025 transcript:ENSMODT00000038201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSSEEEDERDSHDDEDINIIDTEEDLERQLQDKLDESSEQCQEDEQTNQMVMGIQKQID
IMKGKLQETQGRVKRQEDLIIKVENIALKIRLQAMLDEFKQQKEQEKQQLSSLVEQLESL
LEK
Download sequence
Identical sequences F6X418
ENSMODP00000036608 13616.ENSMODP00000036608 ENSMODP00000036608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]