SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036797 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036797
Domain Number 1 Region: 37-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-35
Family Galectin (animal S-lectin) 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036797   Gene: ENSMODG00000003590   Transcript: ENSMODT00000038393
Sequence length 172
Comment pep:novel chromosome:BROADO5:3:117331372:117331890:1 gene:ENSMODG00000003590 transcript:ENSMODT00000038393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSVAQREALEKLEDRHLNNFLGSTFHAEVYLPRLIIPFCGPIKGGMRPGKKILVMGIV
DLNPESFKISLTCGDSEDPPADVAIELKAVFTDKQLIRNSCISGERGEEQSAIPYFPFIP
DQPFRVEILCEHPGFRVIVDGRQLFDFYHRIESLSTIDTIKINGDLQITKLG
Download sequence
Identical sequences F6R5S3
13616.ENSMODP00000036797 ENSMODP00000036797 ENSMODP00000036797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]