SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036800 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036800
Domain Number 1 Region: 288-419
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-35
Family SPRY domain 0.00022
Further Details:      
 
Domain Number 2 Region: 10-75
Classification Level Classification E-value
Superfamily RING/U-box 7.73e-18
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000036800
Domain Number - Region: 91-142
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000104
Family B-box zinc-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036800   Gene: ENSMODG00000025080   Transcript: ENSMODT00000038396
Sequence length 419
Comment pep:novel chromosome:BROADO5:3:116656045:116680000:1 gene:ENSMODG00000025080 transcript:ENSMODT00000038396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYKTLLESLKVDLNCTICMGYFMDPMIINCGHSFCRKCLLRCWKEPPNPNTCPTCGVII
QPENILSNRKLQNLVVSGKLLRSHLLQNKDLSSCEQHGKEETLFWKKRFTSLQPLCGSCF
LAAEHKDHKVLLLGKIVAWYMEGQLYLQELDKEAIEVLATEKSKARSSQKILNLQMILKL
EVHAMKELVLLDFEKKHQFLVKEEKQSLDQEVRDNLAKFEKSKARLRQHIHNLKMVVSAA
EDNFEKPYIDLILMNAYDKKLRMDRNLKSYCKIPVGIPRVSYCEVLSGDITLDPETASLY
LILSDDLKSVTYAYIPEDVPDNPKRSNFDFSVLATQSFTSGKHYWEVDMGGKTDCKESIR
RKGNVFRLSGDVYSVISFKVGNYFYLSPSYYTQIKQCIHMMGIFLDYERGHVAIYNATD
Download sequence
Identical sequences F6W5H9
ENSMODP00000036800 13616.ENSMODP00000036800 ENSMODP00000036800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]