SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036977 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036977
Domain Number 1 Region: 340-594
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.32e-70
Family Eukaryotic proteases 0.00063
Further Details:      
 
Domain Number 2 Region: 110-215
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000144
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0058
Further Details:      
 
Domain Number 3 Region: 258-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 46-106
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000457
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Domain Number 5 Region: 223-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036977   Gene: ENSMODG00000005914   Transcript: ENSMODT00000038574
Sequence length 626
Comment pep:novel chromosome:BROADO5:5:62470835:62520854:-1 gene:ENSMODG00000005914 transcript:ENSMODT00000038574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVLYLLLLLCAGLSSGNNPQQTQGTLLDEKCLREKYTHQSCEKVFCQPWEKCIDGSCI
CKLPYQCPKLVGSVCSTTGRTYNNYCQLKSHECINLKTKFLNNGTCHGQDQFDLSLKFGN
TEAEGLVEVKMGNVTFFMCKNNWGINEENVACFYRGFKGGALDLKKTFQLPADVGVNITD
CLEANCRGLETTLAECVLTKRKANGKKFAGVACSTRDTESPYSSSFQCVNGKYIPENKTC
DGNNDCGDQSDELCCKGCQSTGFFCKSGVCIPKKYQCNGERDCITGDDEINCEGLGLSER
HEDLRTSQDQGTGNDKQEIQEQDEVLTANMDEQRKLLKSLLPTISCGVRNYTHVRRKRIV
GGTIANKGQFPWQVAIKDGEKIHCGGIYIGGCWVLTAAHCVRKNVAHRYQIWTGLLDWIK
VNTGVRIQRVKQVIIHEDYNGVTYQNDIALMEMQKSSSTKKCELTNTIPACIPWSKYLFG
PGDKCVISGLGRDEENKNIYKLKWGQVKLIGNCSKYYSNRFFENEMECAGTDDGSTDACK
GDSGGPLVCMDTNNVSYIWGVVSWGENCGKPEFPGVYTKVANYFEWISHHVGRNIISQYN
GFPEGAERFLPKTSSTPSAKGGIPRR
Download sequence
Identical sequences F6R2B1
ENSMODP00000036977 ENSMODP00000036977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]