SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037082 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037082
Domain Number 1 Region: 41-504
Classification Level Classification E-value
Superfamily Cytochrome P450 1.15e-134
Family Cytochrome P450 0.00000000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037082   Gene: ENSMODG00000003156   Transcript: ENSMODT00000038681
Sequence length 512
Comment pep:novel chromosome:BROADO5:2:31926062:31944932:1 gene:ENSMODG00000003156 transcript:ENSMODT00000038681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPLGNVLPSLQTLLLFSAILLILASYVQRRRRRQQLKYPPGPLRLPIFGNVFQIDTTK
AHVSVQEFVRKFGNIFSMELFGVPMMTVTGLPLIKEVLINQGQVFVDRPQFPLQTYTFKS
VGENPGKVLGLLMSNGQEWKDQRRFTLMTLRNFGLGKKTLELRIQEEATYLIEAIREEKG
QPFDPHFQINNAVSNIICSVTFGNRFEYHDSQFRELLKSLDQVSVLQASWECQFFNIIPW
IMKFLPGAHKKLFREFKKLESFVVHVIKQHKEDQNSEEARDFIDAYLKELSKGNNSSSFN
EDNLVSCTLDLFFAGTETTSTTLRWALLYMALYPEIQGKIQAEIDRVIGHSRQPTMADRE
NMPYTYAAIHEVQRMGNIIPLNAARVATVDTTLAGYHVPKGTWLLTNLTALHRDPKEWAT
PETFNPEHFLENGEFKKRESFLPFSAGKRVCLGEQLARAELFIFFTCLLQRFTFQAPPDT
QLSLDFRTGMTVSPAPYKICAIPRETEPKLSL
Download sequence
Identical sequences F7G8X3
ENSMODP00000037082 ENSMODP00000037091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]