SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037085 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037085
Domain Number 1 Region: 42-491
Classification Level Classification E-value
Superfamily Cytochrome P450 1.96e-128
Family Cytochrome P450 0.0000000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037085   Gene: ENSMODG00000002507   Transcript: ENSMODT00000038684
Sequence length 499
Comment pep:novel chromosome:BROADO5:2:31721114:31844607:1 gene:ENSMODG00000002507 transcript:ENSMODT00000038684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPLGNVLPSLQTLVLFSAILLILASYVQRRRRRRQQPKYPPGPLRLPIFANVFQIDIK
KPHISIQEYVRKYGNIFSMKLLGTPTIIVSGLPLIKEVLVNQGHVFVDRPRLPLQSYSCK
INGLFLSNGQEWKDLRRFTIMTLKNFGLGKKTLELRIQEEAIYFIEAIREEKGKPFNPHF
HINNAVSNIICSVTFGNRFEYHDSKFQELLKSLNQVSVLQTSWECQFFNIFPRIMKCLPG
AHKKLFREFQKLESFVAHMIKQHKEDQNSEEAQDFIDAYLKELSKGNISSNLKENNLVSC
TLDLFFAGTESTSTTLRWALLYMAFYPEIQGKIQAEIDRVVGQSRQPTMADRENMPYTNA
AVHEVQRMGNIIPLNPPRVATVDTTVAGYHMPKGTKVVTNMTSLHRDPKEWATPETFNPE
HFLENGEFKKRESFLPFSAGKRVCLGEKLARAELLLQRFTFQAPPDTQLSLDSLPGLTFT
PVPYKICALLRETPPMLSL
Download sequence
Identical sequences F7G922
ENSMODP00000037085 ENSMODP00000037085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]