SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037142 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037142
Domain Number 1 Region: 92-178
Classification Level Classification E-value
Superfamily PUA domain-like 1.99e-17
Family PUA domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037142
Domain Number - Region: 51-88
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0915
Family Hypothetical protein APE0525, N-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037142   Gene: ENSMODG00000025135   Transcript: ENSMODT00000038741
Sequence length 181
Comment pep:novel chromosome:BROADO5:5:52215995:52216540:-1 gene:ENSMODG00000025135 transcript:ENSMODT00000038741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKKFDEKENVSNCIQLKTSVIKGIKNQLLDQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQRVDKGAIKFVLSGANIMCPGLTSPG
AQLYPAAADTVVAIMAEGKQHALCVGVMKMAAQDIERVNKGIGIENIHYLNDGLWHMKTY
K
Download sequence
Identical sequences F7D612
XP_001364205.1.35504 ENSMODP00000037142 13616.ENSMODP00000037142 ENSMODP00000037142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]