SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037176 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037176
Domain Number 1 Region: 38-493
Classification Level Classification E-value
Superfamily Cytochrome P450 2.1e-140
Family Cytochrome P450 0.00000000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037176   Gene: ENSMODG00000003280   Transcript: ENSMODT00000038775
Sequence length 501
Comment pep:novel chromosome:BROADO5:2:31503853:31545163:1 gene:ENSMODG00000003280 transcript:ENSMODT00000038775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSLWEGASLLTLLLVSTVLLILAFYVQRGRQHPNFPPGPPLLPIFGNIFQMDPKKPQD
TFQEFAKKYGNIFCLKLFGAPMICVTGLPLIKEVLLKQGQVFIDRPQTPWSSYAFKHHGI
SLSNGQIWKDQRRFTLMTLRNFGLGKKTLEFRIQEEATYLTEAIKEEKGQPFDPHFQINN
AVSNIICSVTFGYRFEYHDSQFRELLKILDEVMVLHGRWECQLFEMFPWIMRFLPGPHHK
LFREWKKLQSFVTQIIKQHKEDQNSEEAQDYIDAYLKELSKGDVSSSFSEGNLASCTLDI
FFAGTETTSTTLRWALLYMALYPEIQGKIQAEIDRVIGQSRQPTMADKENMPYTNAAIHE
VQRMGNIIPINVPRVATVDTTVAGYHVPKGTVLMTNLTALHRDPKEWATPETFNPEHFLE
NGQFKKRESFLPFSAGKRVCLGEQLARAELFIFFTCLLQRFTFQAPPDTQLSLDFRTGVT
ISPVPYKICALPRETQPKLDL
Download sequence
Identical sequences F7CLC5
ENSMODP00000037176 ENSMODP00000037176 XP_007480554.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]