SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037259 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037259
Domain Number 1 Region: 413-702
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.77e-76
Family Protein kinases, catalytic subunit 0.000000281
Further Details:      
 
Domain Number 2 Region: 257-340
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-34
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 3 Region: 8-100
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-22
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037259
Domain Number - Region: 116-203
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0628
Family Frizzled cysteine-rich domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037259   Gene: ENSMODG00000001352   Transcript: ENSMODT00000038858
Sequence length 882
Comment pep:novel chromosome:BROADO5:2:27288821:27389244:-1 gene:ENSMODG00000001352 transcript:ENSMODT00000038858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSFLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRISFRATNYGS
RLRIRNLDTTDTGYFQCVASNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYR
GIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPY
CDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAA
NCIRIGIPMADPINKNHKCYNSTGADYRGTVSVTKSGRQCQPWNSQYPHTHTFTAARYPE
LNGGHSYCRNPGNQKEAPWCFTLDENFKADLCDIPACDSKDSKEKNKMEILYILVPSVAI
PLAIALLFFFICVCRNNQKPSSPPAQRQPKHVRGQNVEMSMLRAYEPGTKAKELPLSAVR
FMEELGECAFGKIYKGHLYLPGMDHAQLVAVKTLKDFNNPQQWAEFQQEASLMAELHHPN
IVCLLGVVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLH
IAIQIAAGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLL
PIRWMPPEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCS
EDCPPRMYSLMTECWNEIPSRRPRVKDIHVRLRSWEGISSHTSSTSPSGGNATTQTTSLS
ASPISNLSNPRYPNYMFPAQGIPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPATH
YQPQGPPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLSHVSLPNHPS
GIGITVFGNKTQKAYKVDSKQPSLLGDSNIHGHTESMISAEL
Download sequence
Identical sequences F7FXQ3
ENSMODP00000037259 ENSMODP00000037259 13616.ENSMODP00000037259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]