SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037424 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037424
Domain Number 1 Region: 420-497
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.71e-24
Family Intermediate filament protein, coiled coil region 0.00029
Further Details:      
 
Domain Number 2 Region: 186-220
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000157
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 233-298
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000319
Family Intermediate filament protein, coiled coil region 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037424
Domain Number - Region: 310-417
Classification Level Classification E-value
Superfamily Prefoldin 0.00811
Family Prefoldin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037424   Gene: ENSMODG00000008733   Transcript: ENSMODT00000039020
Sequence length 602
Comment pep:novel chromosome:BROADO5:8:34418021:34425136:-1 gene:ENSMODG00000008733 transcript:ENSMODT00000039020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRQVCKTSGGGSKGFSGRSAVVSGSSRMSCVARTGRTGGGVCGSRGGAGGFSSHSLYNL
GGNKSICSSVAGGSRGGSFGFGGGFGSCGGGFGGGRGVGGGFGGAGGFGGASGFGGAGGF
GGAGGFGGAGGFGGVGGFGGVGGFGGHGGFGPGGFPGGIQEVTVNQSLLQPLNVEIDPQI
GAVRTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTNSVTGTNNLNPIF
ESYISNLRSVLDRLQGERGNLEGELRNMQEQVEDFKKKYEDEINRRTGAENEFVTLKKDV
DTAYMNKVELQARADSLMDEVNFLKTLYDAELSQMQSHVSDTSVILSMDNNRCLDLNSII
VEVQAQFEEITERNKAEITDLYQSKLGELQTTAGRHGDDLKSTKSEIMELNRMIQRIRAE
IENVKKQNANLQTAIAEAEQRGELALKDAQAKLQELQNALQKAKDDMARLLRDYQELMNV
KLALDIEIATYRKLLEGEECRMSGEFQNPVSISVVSSSSSTSASAGGYGGGFGLGGSGGG
RGSGSGFVSSGGSGFGGGSGSGFGGGSGSGFGGGSGSAFGGATTLGGGSAMASALGGGPG
TP
Download sequence
Identical sequences F7FKE8
ENSMODP00000037424 ENSMODP00000037424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]