SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037460 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037460
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 6.2e-20
Family Pyrin domain, PYD 0.0002
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily DEATH domain 2.93e-16
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037460   Gene: ENSMODG00000002568   Transcript: ENSMODT00000039057
Sequence length 195
Comment pep:novel chromosome:BROADO5:6:26862263:26868120:-1 gene:ENSMODG00000002568 transcript:ENSMODT00000039057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRARDLILRALEDLENDDFKKFKLKLRTLKLREGFNAIPRGILENLDRVDLTDKIVCCY
LEDYGLVLTAEVLQEIGMREEAVKLLETGSHLAGNAAQPRQHSSATSTVLGIHFVEKHRT
SLINRVTSVDAILDRLHGSVLSQEQYDAVRAENTHQNKMRKLLGFMVAWDKSCKDQLLEA
LRDLHPYLVQELERN
Download sequence
Identical sequences F7F6C6
XP_007498043.1.35504 ENSMODP00000037460 ENSMODP00000037460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]