SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037465 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037465
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000259
Family Pyrin domain, PYD 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037465   Gene: ENSMODG00000025233   Transcript: ENSMODT00000039062
Sequence length 89
Comment pep:novel chromosome:BROADO5:6:26821969:26822235:1 gene:ENSMODG00000025233 transcript:ENSMODT00000039062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGRDLILQSLNNLNDEEFTRFKFKLHEMPVRISFVYLPRKTVQSLTRLNVANWMVSSL
PENGGVKLTTIMLQGIGKQEEAVRLENAA
Download sequence
Identical sequences F7F6A9
ENSMODP00000037465 ENSMODP00000037465 13616.ENSMODP00000037465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]