SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037514 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000037514
Domain Number - Region: 715-808
Classification Level Classification E-value
Superfamily Prefoldin 0.000811
Family Prefoldin 0.0079
Further Details:      
 
Domain Number - Region: 337-570
Classification Level Classification E-value
Superfamily Tropomyosin 0.000915
Family Tropomyosin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037514   Gene: ENSMODG00000019307   Transcript: ENSMODT00000039112
Sequence length 1138
Comment pep:novel chromosome:BROADO5:5:32192693:32299878:-1 gene:ENSMODG00000019307 transcript:ENSMODT00000039112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAKGHDANQEDVSLSAVRSSGIHEGESMAWWESLCILSHEAQPYPQSLPSTGSASPFLV
STCLRGAVNENPSTPVALTQNPLFTKYEMELETQRKVIPYPGKEHIERVLEEYSHQVKDL
QRRLNESAEMHEKQKFHLRQSVIDLQTKLQEMQMERDALVDIRRRETHSQDDLRNQLQNT
VHELETAKRLQEDMLRESNSQTEQLRKIMLSHEGVLQEIRSILMDYEETTGKRIYEHETI
SSLHVRNLGTAISKLLRELDTEVSYLKGRIFPVEDQLESLKTESQNKIELLLQQHQDRIE
QLMNEHELEVTGLTEKASSARSQANSIQSQMEIIQEQARNQNSMYMRQLSELESTVSQLR
SELREAKRMYEDKIEDLEKQLVLANSELNEARTERDQFSQESGNLDDQLQKLLADLHKRE
KELSLEKEQNKRLWDRDTGNSITIDHLRRELDDRNMEVQRLETLVKTMKTECQGQMERQM
AAIQGKNESLEKVSSLTAQLESTKEMLRKVVEELTAKKMTLESSERTVSDLTQSLQEKER
AIEATNAEITKLRSRVDLKLQELQHLKNEGDHLRNVQSECEALKLQMVEKDKVIEILRQQ
IENMTQLVGQHGRTAGAMQVEKTQLEKEINDRKLELQEFKIIKDKKDSKIRELEARLSDL
ELEKVKLVNAGSERLRAVKDMKQERDQLLAEVKNSRNELSSLSEDYEVLKRNYRNKSEEM
ECTTNKLKMQLKSAQTELEQTRNTLKTMEGSDGHAMKVAMGMQKQITAKRGQIDALQSKI
QFLEEAMTNASKEKRFLKEEKNKLSQELSLVATEKNKMAGELEILRSQERRLKEKVANME
IALDKASLQFAECQDIIQRQEQESVRLKLQHTMDVKELQTPGYSPSPSVKQRIITSLPSS
RPHSANLPSSQSSISYVSHVPPKVSALKEDPTRDLKQLLHELRSVINEEPSVSVPKNDGD
IGRPPPGGGIHMGVDDAVRDPLTESKLRTELFNRDPTTLHAGDLEDTSNTFSFPSSVSPS
IAVGGNRYGTSPKKFSQEPKATERPPAHPILSSSTEDSLSSKSDYRAVKHTHPSDVKASQ
NQPVETTGKTCRKLQNRLESLQNLVEDLQMKNQAMSSMIRNQEKRIQKVKDQEKMLLK
Download sequence
Identical sequences F7BDU1
ENSMODP00000037514 ENSMODP00000037514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]