SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037763 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037763
Domain Number 1 Region: 4-449
Classification Level Classification E-value
Superfamily Cytochrome P450 5.76e-90
Family Cytochrome P450 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037763   Gene: ENSMODG00000007024   Transcript: ENSMODT00000039368
Sequence length 449
Comment pep:novel chromosome:BROADO5:8:17791401:17797002:1 gene:ENSMODG00000007024 transcript:ENSMODT00000039368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRSSGKVFSVQLLWKPAVVLSRPDAVREALVHRSEDTAGRPPSLVYSHLGFGPKCPRQVP
GAGGLCRPRGRVVLAQYGEAWKEQRRFSLTTLRNLGLGKQSLERWVTAEADFLCSAFAAR
EGRAFDPSHLLTCSVTNVISSLTYANRFDYEDRKLQRLLELLERSLKEDVGLLREVGGPL
PPSLEKGYGLTIHMPGGRRLAPGAPPYPPPLCPQAKGTPGSSFTPANLRMVVADLFTAGM
VTTATTLRWALLLLLLHPDVQRERRLPLLGLPKPPPSFSPGKVQEEVDVVIGRSRRPTMK
DQAHMPFTNAVIHEVQRFGDIVPLGIPHMTTRDTEIQGFFIPKGTVLITNLSSVLKDEAT
WEQPYRFYPEHFLDAEGRFVKPEAFMPFSAGRRVCLGEPLAKMELFLFFTCLLQDFSFVL
PPGHSKPSDKAEVSFLSAPQPFQLCAVPR
Download sequence
Identical sequences F6ZAY4
13616.ENSMODP00000037763 ENSMODP00000037763 ENSMODP00000037763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]