SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037982 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037982
Domain Number 1 Region: 141-241
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000162
Family Myosin rod fragments 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037982
Domain Number - Region: 222-296
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0207
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037982   Gene: ENSMODG00000001043   Transcript: ENSMODT00000039584
Sequence length 683
Comment pep:novel chromosome:BROADO5:2:3802669:3830543:1 gene:ENSMODG00000001043 transcript:ENSMODT00000039584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVPEEAFVGGHTPRPADKRCSSARVPGAVPAAPPSGGFGPRSTASPLPLRAASPAGRDK
EPNEYGLSWEAWGEGVRVTLSPSLWLKRPEPEPGARDGGALLSPECGGIWGGGGGRAAAM
MRVVRDCLKSPRPPPPPADAREKSSVEQDLQEKEDHIRHRTSEVQDLQDEVKRESSNLQK
LHAQKQEVQDLLSGLDEQKAALEEQLSDVRQQCAEEAHLISSLKAELTSQESQISTYEEE
LSKARAELSRLQRETAELEESVEAGKAQLAPLQQHLHQSQQELTSMQVRLTEMKELDASS
SQENWLRGSHSLLVNGAAEYCSLSNSSSETANLHEHLDTPTALETEPGPQESPVRSSPEV
PSSEVADEKEGATHSVLEKEDFFSIDSSSLSDTAVESNLDFFQSDPFVGRDPFKDDPFGK
IDPFGGDPFKGSDPFAADCFFKPSVTDLFAAPELDPFSAASSSSDLMMETLKDNDPFAPG
GTVVAAASDPAVDPFTSVFGSDSCEVGFADFSSLAQDNSEEAFISTTSSSGDSVTLTPGA
FEEPPPVKDEEVPPALPPKTGTPTRPCPPLPGKRPLSQLDSSDSLKLNDPFQPFAGNDTP
TETALDLYRGPQHTSASATVAHTEAAPSRGANVGAYPTEEDLIEWAKRESEREEKERLAR
LNQQEQEDLELAIALSKSEISEA
Download sequence
Identical sequences F6YJM0
XP_007480247.1.35504 ENSMODP00000037982 ENSMODP00000037982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]