SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038228 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038228
Domain Number 1 Region: 332-408
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.89e-19
Family Intermediate filament protein, coiled coil region 0.00064
Further Details:      
 
Domain Number 2 Region: 99-133
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000994
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 147-210
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000162
Family Intermediate filament protein, coiled coil region 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038228
Domain Number - Region: 254-332
Classification Level Classification E-value
Superfamily Prefoldin 0.0262
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038228   Gene: ENSMODG00000025452   Transcript: ENSMODT00000039828
Sequence length 451
Comment pep:novel chromosome:BROADO5:8:34495969:34510963:-1 gene:ENSMODG00000025452 transcript:ENSMODT00000039828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRFGGAAYCSPRGSFGSHSHHNLGSNTRISVCMAQGASHGRPFGGFGVGTGNFLGLCNSR
PNFGASCPPGGIQEVTVNQSLLTPLNVEIDPEIQRVRTQEREQIKTLNNKFASFIDKVRF
LEQQNKVLETKWDLLQKQSQNNMTAMDLGPFFKQYIGNLQRHLNGLQNERKKLDHELSDA
QDKMEKLKISYEKEINKRTAAENEFITLKKDADALHILHANLEGVCESLSEEYTFLKILY
EMELCQVQTLVSDTNVVLSMDDNRCLDLKSIIAEVKTQYEEIAKRSRAEAESWYQTKYEE
LKVTAGKHEEYLRETKKEIAELTHAVRRLKGEIDSMKKQCKRLQTAIADAEQRGELAIKD
AKKKLGDLKTALHHTKEELTKLLRDYHELMNVKLALDMEITTYKKLLECEESRMSGECSS
AVSISVTGCSTNMHGGSSRGVGSGSSGDGVS
Download sequence
Identical sequences F6RKV2
ENSMODP00000038228 13616.ENSMODP00000038228 ENSMODP00000038228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]