SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038268 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000038268
Domain Number - Region: 166-237
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0201
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038268   Gene: ENSMODG00000025486   Transcript: ENSMODT00000039868
Sequence length 377
Comment pep:novel chromosome:BROADO5:7:180415583:180700136:-1 gene:ENSMODG00000025486 transcript:ENSMODT00000039868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRTLSGPRPLDVGQGSVLMGAEETAEAVASEGAYYLEQVTITEPSETDYQYEEVSEQDD
LSIPEGDEDLTKALEMAQEKSMDCKLLASKVAIPPKQSLAEVPEVVEDFLCNFLIKMGMT
RTLNCFQNEWYESIQKGTFVPPEATFVPDVYTQNLLLDSENKNLKKDLKHYKEAADKARE
DLLKAQKERDFHRMHHKRIVQEKNSLISDLKGLKLHYASYEPTIRVLHDRHHILLRQKML
TSLERDKAVGQITGLQTTLRNLETGHTLQVPEIRVGHRCERDDKPEGPTQKALREAREQA
KPKTKMKSSTKDSEFPVNIQPNPNLYFYKEIVTPPKTEYKLSNIFRLHELPVSCRREYKK
SHCTMPKKHKAVLYSAN
Download sequence
Identical sequences F6QZ24
ENSMODP00000038268 ENSMODP00000038268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]