SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038279 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038279
Domain Number 1 Region: 88-139
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000115
Family AN1-like Zinc finger 0.0012
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000471
Family AN1-like Zinc finger 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038279   Gene: ENSMODG00000025494   Transcript: ENSMODT00000039879
Sequence length 145
Comment pep:novel chromosome:BROADO5:6:69732080:69734427:-1 gene:ENSMODG00000025494 transcript:ENSMODT00000039879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPDLGKHCSEKTCKQLDFLPLECDGCNKVFCKDHHKSSRHKCSAAYKKDVQVPVCPLC
WAPVPVGRGEIADIVVGKHMDDDCKHNPAKEKPKIFIHRCSKEGCKKKEMLKLVCEQCQD
NFCIKHRHPLDHNCKHRDHPISKAG
Download sequence
Identical sequences F6QYK0
13616.ENSMODP00000038279 ENSMODP00000038279 ENSMODP00000038279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]