SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038280 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038280
Domain Number 1 Region: 37-372
Classification Level Classification E-value
Superfamily Cytochrome P450 1.06e-76
Family Cytochrome P450 0.000000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038280   Gene: ENSMODG00000025495   Transcript: ENSMODT00000039880
Sequence length 457
Comment pep:novel chromosome:BROADO5:6:80548698:80581162:-1 gene:ENSMODG00000025495 transcript:ENSMODT00000039880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIIPNLSAGTWTLIILFLTILYLYGTRTHKLFKNIGIPGPTPFPFIGTILYYRKGIVGF
DYGCYKKYGKTWGFFDGTKPVLAIMDPETIKTVLVKECYSVFTNRRMLGLSGILEKAISI
AEDEEWKRIRTVLSPAFTSGKLKEMFPIINQYGDVLVKNMKKEAEKSKPVTMKEIFGAYS
MDIIISTSFGIHVDSLNNPNDPFVREIRKLIRFSFLDPLILSITIFPFLIPLFKKLDITV
FSKDATDFLGKSILRIKEERKKSTEKHRVDFLQLMMDSQTSKNSESHSQKDLSDEEILAQ
SIVFIFAGYESTSSVLSFLFYHLATNLEIQEKLQKEIDAVLPNKEAVTYDALVQMEYLDM
VINENLRLYPISDSSEAEQSATPYTFCTYCPASCIKKQERESTLEIFHLTLLIPIYNHVS
HSSTIFQEQNIPGLQKQLNSSYEPNKEIKMRLFVCFF
Download sequence
Identical sequences F6QYJ0
ENSMODP00000038280 ENSMODP00000038280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]