SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038364 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000038364
Domain Number - Region: 123-194
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000288
Family Myosin rod fragments 0.026
Further Details:      
 
Domain Number - Region: 55-109
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000602
Family Myosin rod fragments 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038364   Gene: ENSMODG00000009974   Transcript: ENSMODT00000039964
Sequence length 231
Comment pep:novel chromosome:BROADO5:4:309205234:309303228:-1 gene:ENSMODG00000009974 transcript:ENSMODT00000039964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDGSGKKTKASQAGGIGDSDVRKKPIKEINTIKCRNRELKKNYKDIVQLTTLEIRNKIV
ELEEELKSVEDEGNEWKTRYEAQTELNNQLEKQILGLQEKMAKIHGNPSDRLSSIRIYER
MPMNSLNQLLKQLEKEKRSLEYQVKEYEHRLEQASKAFHKTNDERRAYLAEMSQLTISQS
SKKQSMDSLPKMKENHLKRGRGISAYWRTADFKKGPIKKTARTNHLPKLNP
Download sequence
Identical sequences F6UHR2
ENSMODP00000038364 ENSMODP00000038364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]