SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038461 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038461
Domain Number 1 Region: 337-607
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000696
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 2 Region: 64-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000512
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038461   Gene: ENSMODG00000025645   Transcript: ENSMODT00000040061
Sequence length 620
Comment pep:novel chromosome:BROADO5:3:445479080:445511575:1 gene:ENSMODG00000025645 transcript:ENSMODT00000040061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVPGLCVLLTLTRAVTDQKNSQCPPQCPKYATCINGTHCTYNDRFASLSRKKNFNGPLK
KCEDINECAPPNSVNCGPNADCVNTQGSFHCRCRHGFAQKTFQSNQRITCYVSTNRNANQ
NNSETSHIYYIGNNKKEKEMLEGMQKNEDTNTLLELQTDPTILDSNLKLSPKYYKIMSNP
AVAGSISQRDKGKGERFYKFQNIYSSSLCDGKELEIEISINGIAGQTTISFNSGQKPNCR
GFEESEKRQSRIKTAFSRSLAQKRKRNIGRLVGMMRSIKDIFKMKAWTVVSNQAVKWEQK
QLMTIRKMRSEIDDTELTRLSKSWLLGEKKQEEDCVLTMITYVGLSLSLLCLFLAALTFL
LCSTIQNTSTSLHLQLSLCLFLADLLFLTGIKQTKNKVLCSSIASLLHYFYLASFTWMLL
EGLHLFLTARNLMVVNYTRMTQSLRKVMYPLGYGIPAVIVTTSAASGAPLYGTSSRQVDC
WLHLEKRFLWAFLGPVCTIFCVNLALILQVLWVLQNKLSSLNNEMPTLQDTRLLAFKAMA
QLCILGCTWCLGVLQMGPTAQIMAYLFTIINSLQGVFIFLVYCLLNHQVREQYKKWFMTL
RGKTSRSQSLELSINNIPDS
Download sequence
Identical sequences F6XVQ8
ENSMODP00000038461 ENSMODP00000038461 13616.ENSMODP00000038461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]