SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038473 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038473
Domain Number 1 Region: 1-370
Classification Level Classification E-value
Superfamily Cytochrome P450 3.27e-106
Family Cytochrome P450 0.000000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038473   Gene: ENSMODG00000025653   Transcript: ENSMODT00000040073
Sequence length 371
Comment pep:novel chromosome:BROADO5:2:31608142:31716210:1 gene:ENSMODG00000025653 transcript:ENSMODT00000040073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKYGNIFSIELLGTPMIVVTGLPLIKEVLVNQGHLFVDRPRAPSQSYIFKINGLFLSNGQ
EWKDQRRFTIMTLKNFGLGKKTLELRIQEEAIYFIEAIREEKGKPFNPHFHINNAVSNII
CSVTFGNRFEYHDSKFQELLKSLNQVSVLQTSWECKFFDSFPRIMKCLPGAHKKLFREFQ
KLESFVAHMIKQHKEDQNSEEAQDFIDAYLKELSKGNISSNLKENNLVSCTLDLFFAGTE
STSTTLRWALLYMAFYPEIQGKIQAEIDRVVGQSRQPTMADRENMPYTNAAVHEVQRMGN
IIPLNPPRVATVDTTVAGYHMPKGTKVVTNMTSLHRDPKEWATPETFNPEHFLENGEFKK
RESFLPFSAGE
Download sequence
Identical sequences F6XDY3
ENSMODP00000038473 13616.ENSMODP00000038473 ENSMODP00000038473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]