SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038497 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038497
Domain Number 1 Region: 287-365
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.31e-23
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 54-89
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000785
Family Intermediate filament protein, coiled coil region 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038497
Domain Number - Region: 169-283
Classification Level Classification E-value
Superfamily Prefoldin 0.00628
Family Prefoldin 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038497   Gene: ENSMODG00000025669   Transcript: ENSMODT00000040097
Sequence length 366
Comment pep:novel chromosome:BROADO5:2:196661620:196666471:1 gene:ENSMODG00000025669 transcript:ENSMODT00000040097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGGGFSSISGMGGHGGDWGSGAGFGGGFSSYCAGALGSGGTGSLGASDGGLFSGSEKQTM
QSLNDRLASYLDKVHALEEANTDLEVKIKEWYDKSGNKDADSKKDYNKYYQIIEGLRNQI
IEATIDNAKIMTPIDNARLAAEDFRMKYDNELCLRQSVEADINGLHKVLEELNMTTSGLK
MQFESLNEELVYLKKNHEEEMNSTQGKNHGDVSVEMNAAPGMDLTKMLNNMRAQYEELAE
QNRREAEDQFQKQSSALQAQIITDTGATDSAKSEMMELKRTLQGLEIELQSLMAMQDSLE
GTLADTEADYVARLSQMQLQISSLEQQICQIRGEMECQNTEYEQLLNIKTRLEMEIETYR
SLLDGE
Download sequence
Identical sequences F6XDA3
ENSMODP00000038497 ENSMODP00000038497 13616.ENSMODP00000038497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]