SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038518 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038518
Domain Number 1 Region: 43-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000321
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 2 Region: 9-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000108
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 3 Region: 83-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000223
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038518   Gene: ENSMODG00000025687   Transcript: ENSMODT00000040118
Sequence length 112
Comment pep:novel chromosome:BROADO5:2:314085770:314102552:-1 gene:ENSMODG00000025687 transcript:ENSMODT00000040118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEGVYCETDTNECISFPCQNHGHCMDGVNSYSPGFSGSQCEIEINECYSTPCKNNGTCVD
LINRFLCTCPPGYNGSFCELEIIKCQSLLCLNGGSCKKHLGDYYCLCAPGFT
Download sequence
Identical sequences F6TZZ5
ENSMODP00000038518 13616.ENSMODP00000038518 ENSMODP00000038518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]