SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038535 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038535
Domain Number 1 Region: 24-490
Classification Level Classification E-value
Superfamily Cytochrome P450 9.3e-104
Family Cytochrome P450 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038535   Gene: ENSMODG00000025699   Transcript: ENSMODT00000040135
Sequence length 491
Comment pep:novel chromosome:BROADO5:2:7519179:7551168:-1 gene:ENSMODG00000025699 transcript:ENSMODT00000040135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLGLVWKFGLSLLLLFIVKLCIWYWRRIRALRFFPAPQTQWLYGNVKEIHSEETYWKSLP
WAHTLLWPFPVLFTQRTGSLVVNSPSLEAFKKFGDPLLRLLLGFFQYMGKGLLSLEGEKW
HYHRRLLTPAFHFNILKDYIYIMRNTVSLMLDKWEKLRTKDSSIDVFDFISYMSLDTSLK
ATFGLQDFNKEESLFSYFQNMNKLLYLVRKRMETFLYYSDFIYKLTSDHYEFQTTCKELK
EEPAKIIRHRRALYKNQSEKDKVPKKKYLNFLDILFQAKDEDGGGFTNEELENEVNTFRF
AGQDTVAVGFSWTLYCLAMNPEYQKKCREEIQGILKDGESITWDHLTQMTYSTMCIKESF
RMYSPIPKVARTLNQPITFPDGQTLPSDTTVTINIWALHYNPAIWENPKVFDPERFTPEN
TKKRHPYAFLPFSAGLRNCIGQQFAMNLIKVSLALTLLRFELLPDLEKPPIPISQIVLRS
TSGFHFYLKPL
Download sequence
Identical sequences F6TJ06
13616.ENSMODP00000038535 ENSMODP00000038535 ENSMODP00000038535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]