SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038549 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038549
Domain Number 1 Region: 305-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-49
Family SPRY domain 0.0001
Further Details:      
 
Domain Number 2 Region: 37-148
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 162-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000501
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038549   Gene: ENSMODG00000025708   Transcript: ENSMODT00000040149
Sequence length 528
Comment pep:novel chromosome:BROADO5:2:268827081:268837671:1 gene:ENSMODG00000025708 transcript:ENSMODT00000040149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGALRKMVGFLRSFLSRCLISLLILQMTVCVSEQFKVLGPTGPIVAILDTDVTLPCRLS
PLMNAEHMDIRWLRSQFYEAVFVFQNGREQVGEQLVEYMGRTEFISDFIKEGRVAVKIYN
VKMSDNGEYQCIFQEGDAYEKAVFEVKVASLGSAPRFHLEGYEDGGIRLVCSADGWFPQP
QVQCRDNRGGKLSSLSETQAQDEAGFFHAKTVIVVQDSSVRNISCSIYNLLLGQGKVSTI
DISEPFFPKTSPWKKALIGIIPVMVIFLGISIFFILKERKKTKKLLQEKEEEQKYKDNLR
TELAWRKAHIYAVNVTLDPASAHPGLVLSRNGKVMRVKNAVKSAEETFSVLGWGPITSGR
CYWEVKVEMEAQNKATWHLGICREGASWSGLFRESPEMKFWAVGCSDGIFRPMTDECVLS
PSLGKPPEQIGIFLDCEAGDVSFYNMTDGSHIYNFPPASFSSPVCPYFSIQTLNTSFTIC
GVSDRPESIPAPSLETPGTAQEQEKFLGDKNKAPEDKSTTRQSFSASL
Download sequence
Identical sequences F6TIB4
ENSMODP00000038549 ENSMODP00000038549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]