SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038564 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000038564
Domain Number - Region: 49-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Cripto EGF-like domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038564   Gene: ENSMODG00000025719   Transcript: ENSMODT00000040164
Sequence length 112
Comment pep:novel chromosome:BROADO5:1:14208385:14249304:-1 gene:ENSMODG00000025719 transcript:ENSMODT00000040164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVILGVLLTWTIVTLCDDQCTINPLKSTVGKQPKDCKDRHGEIHEFNFSWITEDCEICHC
LIEGMKCSSAILRPMGYDKKKCKEVFNAEECIYKAVEKNNPSQSCKVSKYII
Download sequence
Identical sequences F6T2P6
ENSMODP00000038564 ENSMODP00000038564 13616.ENSMODP00000038564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]