SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038595 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038595
Domain Number 1 Region: 43-551
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 5.89e-179
Family Myeloperoxidase-like 0.000000000000588
Further Details:      
 
Domain Number 2 Region: 2-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000559
Family EGF-type module 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038595   Gene: ENSMODG00000025748   Transcript: ENSMODT00000040195
Sequence length 553
Comment pep:novel chromosome:BROADO5:1:416005263:416020334:1 gene:ENSMODG00000025748 transcript:ENSMODT00000040195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVNPCCYYPCQNKGICIHFELEKYQCDCTRTGYYGPNCTTPLLWTRIREGLSPSPSFTDF
LLTHIRWIWKLINATFLRDVLMRLIITSRTNLIPSPSTYNSHHNYITWESYSNLSYYSRV
LPPVPEDCPTPMGVKGKKQLPDPEVLVKSFLLRKEFVPDPQGSNLMFAFFAEHYTHQFFK
DFGEFNPALTKARGHGVDLSHIYGDNLQRQQQLRLFKDGKLKFQMMNGQMYPPSVSDTQA
YMNYPSTVPKSQQMAVGHEELGRHPGLMMYATIWLREHNRVCDILKSEHPTWKDEQLFQT
ARLILIGETIKIVIEEYVQHLSGYNLKLKFDPELLFGVPFQYQNRISLEFNHLYNWQLFM
PDSFLVGNKEHNFEQFSFNTFILSSYGVEVLVDSFSQQSTGKIGGVNNINHSLRSVVENT
ILESRRLKFQSFNEYRKRFGLKPYTSFQELTGENEKSAELEKLYGDIDAVEFYPGLLLEK
SLPNSIFGESIMNIGSIFSLKILMSNPICSPEYWKPSTFGGQVGFNLVKTATLQKLVCLN
VKKCPYVSFRVPE
Download sequence
Identical sequences F6T1R2
13616.ENSMODP00000038595 ENSMODP00000038595 ENSMODP00000038595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]