SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038636 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038636
Domain Number 1 Region: 32-494
Classification Level Classification E-value
Superfamily Cytochrome P450 2.88e-132
Family Cytochrome P450 0.0000000000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038636   Gene: ENSMODG00000025781   Transcript: ENSMODT00000040236
Sequence length 494
Comment pep:novel chromosome:BROADO5:1:17230738:17267692:1 gene:ENSMODG00000025781 transcript:ENSMODT00000040236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPWGLTTPILVFFVSFLVFLSLWKKDYKGRNLPPGPVPLPIIGNILQIDHKNFFMSLNK
LYEKYGPVYTIYLGSQPVVVLHGYKALKEALIDQGDIFGGRGKVPVFENTFKGNGIVFSH
GEKWKQIRQFSLMTLRKFGMGKRSIEERIQEEAQFLIKELKKTNSQPFNPHVILQYAPFN
VISSILFHQRFNYDNEDFLSMMHILNENAILLNSPMIQLYNYFPWLFHYFMSHHKKFFSN
TEATKKIFLDQVKKHQDTLDLNNPQNLVDCYFHKMQQEQKNPDSVFDMENLAAIGVDLFG
AGTTTTSTTLAFSLFLILKHPEVQDKIHEEIDQVIGPHRIPSIKDKLEMPYTDAVLHEIQ
RYINIAPISMPHEVTHDTQFRQYFIPKGTMVFPFLSSVLFDPIEFPNPYQFDPGHFLHQD
GRFKNSDYFMPFSIGKRACLGEGLAKMELFLLLVTILQNFTIKSVIDPKEIIIKPMSTRG
VSCPPKYQLCFFPR
Download sequence
Identical sequences F7FSV0
ENSMODP00000038636 ENSMODP00000038636 XP_007478162.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]