SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038640 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038640
Domain Number 1 Region: 62-353
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.25e-40
Family beta-glycanases 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038640
Domain Number - Region: 559-682
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0844
Family Laminin G-like module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038640   Gene: ENSMODG00000025784   Transcript: ENSMODT00000040240
Sequence length 685
Comment pep:novel chromosome:BROADO5:1:229556608:229663035:1 gene:ENSMODG00000025784 transcript:ENSMODT00000040240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPCKVWTNRLRAEGRLLLWLLLLLTPLSATGSFRHRLFGLGTTLQKFQYTLDDSAGHGR
VFDGIGAISSGGAATRLLLNYREPYRSEILDYLFKPNFGASLNILKVEVGGDGQTTDGTE
PSHMHSSNEMGDYRRGYEWWLMKEAKKRNPNIKLIGLPWAFPGWLNPSRRDPYANMTMTA
LYVVSWILGAKKHHKLDIDYIGIWNEKDPDKNYIKALRNMLNHKKLNRVKIIANDHNWAP
ISVYLEVDAEFTNIVDVIGVHYTANQSNAKALESKKKLWSSEDCNNFKEETGRGFWARNL
NQNYVIGHITATIAWNLVGSYYPQSPYEKDGLLTAKEPWSGHYVVEAPIWITAKKTLKSP
PEYFYDTNSHHLDGLNLFLILQEMTGAMLKTSKGKAKSNASPRESLIFFDGTRESTWKLL
QGFSYFPNQMPYVQYLHVSSQSLFKDLYTVKVESTRHGYGVDENEESGMTLKLYSAEECC
ILCPPCPCPQLQNDSIKVCDQCFSAAPHFADQAGVFEYHTNDNDMEEHTFTFRQMLTQRP
ISWVLDAEETISIIGDRNWKDIKITCDVYMESSTKGGIFIAGRVNKAGSYVRNTQGVFFW
ILANGTYEVTSDLASTNLIKRGNAGIMVERWHTLTLVITETSAYGMLNSTHIWTTLMRPF
PKNGWAAIGTRGYEAGQFDNFYVDA
Download sequence
Identical sequences F7FSR3
ENSMODP00000038640 ENSMODP00000038640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]