SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038702 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038702
Domain Number 1 Region: 84-249
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-53
Family RUN domain 0.0000000273
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038702
Domain Number - Region: 289-336
Classification Level Classification E-value
Superfamily Prefoldin 0.00136
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038702   Gene: ENSMODG00000019087   Transcript: ENSMODT00000041810
Sequence length 488
Comment pep:novel chromosome:BROADO5:5:18609426:18704745:1 gene:ENSMODG00000019087 transcript:ENSMODT00000041810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
SWEDLTELVEQIRGDPEDPNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQ
QFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAGEITASVKDLPGLKTPVGR
GRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANF
CMKGEDLDSQVGVIDFSMYLKDGNSTKGNEGDGQITAILDQKNYVEELNRHLNATVNNLQ
AKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKVTKQDRTADGQAL
SEARKHLKEETQLRLDVEKELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLR
ALKHELSFKLQSSDLGVKQKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNCAAS
KLIPKHHH
Download sequence
Identical sequences K7DYV1
ENSMODP00000038702 ENSMODP00000038702 XP_016278429.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]