SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038771 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038771
Domain Number 1 Region: 1091-1257
Classification Level Classification E-value
Superfamily C-type lectin-like 1.91e-74
Family Endostatin 0.000000134
Further Details:      
 
Domain Number 2 Region: 38-234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-33
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 3 Region: 738-887
Classification Level Classification E-value
Superfamily C-type lectin-like 1.84e-19
Family Endostatin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038771   Gene: ENSMODG00000029358   Transcript: ENSMODT00000041878
Sequence length 1263
Comment pep:novel chromosome:BROADO5:6:138210480:138435569:-1 gene:ENSMODG00000029358 transcript:ENSMODT00000041878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRQSWGSRGLSVLLWPALISAVTLAQITDEQGSKGHLDLTELIGVPLPSSVSFITGYG
GFPAYSFAPGANIGRPTRTLIPETFYTDFAISVTVKPDSNHGGVLFAITDAFQKIIYLGL
RLSQVQDGTQKIILYYTEPGSHVSQEAASFKVPVMTNKWNRFTVVIEGSDVILLVDCEEH
NRIQFLRSSQALRFESSSGIFVGNAGATGLERFTGSIQQLTIQPDPHPSKDQCEDDDPYA
SGETSGFQEAEDVAEIQEAITYTQPPPEETKAEPVEEPPTTLPESKEMELSGDAETEDGP
EAEDNPTAKDTSKTEDSPEITNSSYTNSSNSEQGSGDIVHDKQEEDNATDSDPEAETKNA
QEFGSGNEEFLEISGDKDTTDEENLTETQTPTRSPEKDDENNLPTYGPSQPGPTVQPGRG
DILGERGLPGPKGQAGPKGEKGDPGEGQPGLPGFPGSPGPTGPPGTLGIMEIDGSGFVSG
SGSGSGSGFGSDSDSSSVNFEVSGELLRGPTGPPGPPGEPGLPGEPGSELHIGPPGSPGE
DGPSGEPGPPGPDGHPGLNGAAGLPGMKGEKGEKGPNGSIGEKGDSGKRGLPGPPGKDGV
VGEPGPPGLPGPPGPPGASCGMGLGFEDIEGSGSVSLLSEPKTPGPTAPNGSKGEKGDQG
PKGEKGRDGESLIGPPGPPGPPGPPGRTVAVTSSILNGTDGIENIAELPELTGPPGPKGP
KGDTGFPGLPGEKGEKGEPGTIFTGNIPLERLMLKKGEIGIQGPPGPMGPKGPPGHKGEL
GFPGRPGRPGLNGLKGAKGERGMVLLGPPGLPGPPGPPGPPGAMINIKGTVFPISPRPHC
KTPVATTHPGNQELITFHGVKGEKGSWGLPGQPGPKGEKGDEGEPGPPGPPFPITYLKHF
MDRMKGESGNKGIKGEKGDSNGVFFMPGPPGLPGSPGQVGQKGDSVIGPRGLPGPPGLPG
PIGYGAHGPPGPPGPQGPPGPPAILGSAVALPGPPGPPGQPGLPGSRNLVTTFGNIESMM
QNAHLVIEGTLIYLSESTEFFIRVRDGWKKLQLGELIPIPADSPPPPAISSNIQQPLPPP
IPASNTYSEKPALHLVALNMPFSGDIRADSQCFQQAQAAGLLSTYRAFLSSHLQDLSTIV
RKSDSYSLPIVNLKGEILFYNWESIFSGHGGQFNNQVPIYSFDGRNVMTDPSWPQKVIWH
GSNTNGIRLVSNYCEAWRTADIAVTGNASPLSTGKILDQKTYSCANKLIVLCIENSFMTD
IRK
Download sequence
Identical sequences K7DZ20
ENSMODP00000038771 XP_007499081.1.35504 ENSMODP00000038771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]