SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038778 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000038778
Domain Number - Region: 197-238
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000327
Family LDL receptor-like module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038778   Gene: ENSMODG00000029580   Transcript: ENSMODT00000041885
Sequence length 240
Comment pep:novel chromosome:BROADO5:Un:18330270:18335382:-1 gene:ENSMODG00000029580 transcript:ENSMODT00000041885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARRVFPPASCATASAPAHVERMKTRLYAGTSPTACPASWCSDAATPPPGPLRTRDATG
PTTVETALMKAPVSAPRFGLAGARGGPRQAQTPFFYLNPDFRLGLVRGRAIGARQGGSSD
LSRVTQQGSVRARMWPKAQRREKAFSAEWRAGGGLRGGQGGVWLESSLPSSAIRGAESRE
RRQPSGSSVSPVARCPPCGPQGWGCTPTFFQYCGCVPRSLCRDGVQHCSDWSDEYACPGR
Download sequence
Identical sequences K7DZ27
ENSMODP00000038778 ENSMODP00000038778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]