SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038789 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038789
Domain Number 1 Region: 1095-1264
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-43
Family C-type lectin domain 0.00000821
Further Details:      
 
Domain Number 2 Region: 148-267
Classification Level Classification E-value
Superfamily C-type lectin-like 3.36e-39
Family Link domain 0.0031
Further Details:      
 
Domain Number 3 Region: 260-360
Classification Level Classification E-value
Superfamily C-type lectin-like 1.11e-27
Family Link domain 0.0044
Further Details:      
 
Domain Number 4 Region: 1265-1324
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 1061-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000255
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 6 Region: 53-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000159
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038789   Gene: ENSMODG00000028358   Transcript: ENSMODT00000041896
Sequence length 1329
Comment pep:novel chromosome:BROADO5:3:449391797:449466987:1 gene:ENSMODG00000028358 transcript:ENSMODT00000041896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPSFWAACGLLLQMLFLWVWGQGTQDGEEVIQIQKVTHGTVRAGLAELVALPCLFVLR
HPQKPGPPHDPARIKWTKVRAASGQRIELPVLVAKDNVVKVARGWQGRVTLPGYPQNRSN
ATLVLGPLRASDAGLYRCEVVTGIEDEQDLLPLEVTGVVFHYRAALGRYTLSFQAAREAC
RRNSAVIAAPRHLQAAFEDGYDNCDAGWLSDRSVRYPITLSRPGCYGDRNSLPGVRSYGR
RDPHELYDVYCFARELKGEVFYVSPPSRLTLWGARAQCRSQGAELATVGHLYLAWQEGLD
QCDPGWLADGSVRYPIQTPRRRCGGEAPGVRTLYNFSNRTGFPEPSVKFDAYCYRAHHPT
SPPRYQDNPATDGEDLESLSAEDLPITGQENALPLDSQEPLVFSGVPADEQSQDSSLLPN
EAGSGKTGGTPVPFPGRLSSVRTTSQRPEPAKQEEPWLNMVDRTPMPGGFQIETVLPEGT
ETQHPAMVGAESATPNPGITGDLKAKGTVASATEMGMESDAQSLSSTEATPVGTTARRRG
LNGRYFQQQHLEQATSRTGWGIRTGTSPTLPGTKETGNHVELPLITATRPMLDPQNTLSN
EVDRSHSSSSGIQSEGTPLNPNSVPSPAPKKKEDAFPGSQNSPWDPEQGTSGPSKDPHLG
VEPGEPEDSSGEAHGDRDLPVLAMLRAPKPPLMSLPTPTLDTYFPVSVRDDMGLSEYGGT
TPAPETPHSPFPPYTDWPVEGRDILGETGIKPEINGTESPVPSTFPGPSPQNKGDLEGDS
WSLTVGWDNKQLEQSKEASPTEYAGSHENLGLGSTLPNEEDTSSPRPGSGLMLAQDTTTQ
LETGEESKGMKEFDFHTPSPSPALVLGTQNQQLSPDPEARTSEPTSQETSKLATSSLQPA
SEAELSIELPLATLDLVSPVSPQGRSPLGEAVFMPWTSGASTLANNNWATPATPEPEGDD
TSGEGQKGDSPLWEASQTKVPLLPGLEDSEPTRDTTQHIQRHSLGDLEIPDPQEVGPSST
LDAGAHVLGEVGSGEESSIMGEVESGSWAGESNRSKEEVPANPCENNPCLHGGTCQANNS
TFGCSCDHGFTGENCEIDIDDCLSSPCLNGGTCIDEVNSFICLCLPSYGGSLCDKDTEGC
DHSWHKFQGHCYRYFAHRRAWEDAERDCRRRAGHLTSIHSLEEHGFINSFGHENTWIGLN
DRIVERDFQWTDNTGLQYENWREKQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVC
KKGTVLCGPPPAVENASPVGPRKAKYSIHSSVRYRCDKGFTQHHVATIKCHSNGKWDRPK
IVCTKQSIL
Download sequence
Identical sequences K7DZ38
ENSMODP00000038789 ENSMODP00000038789 XP_007489260.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]