SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038842 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038842
Domain Number 1 Region: 67-138
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000125
Family TNF receptor-like 0.003
Further Details:      
 
Domain Number 2 Region: 26-71
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000526
Family TNF receptor-like 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038842
Domain Number - Region: 140-163
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0863
Family TNF receptor-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038842   Gene: ENSMODG00000027363   Transcript: ENSMODT00000041949
Sequence length 277
Comment pep:novel chromosome:BROADO5:4:435120637:435137738:1 gene:ENSMODG00000027363 transcript:ENSMODT00000041949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSPEKLEAILALAILPWLTLVQGSCSSCPAGTFWNGTDCGKDKNQACIPCPPNSFSST
AGDQRTCDICRRCKGTFRTKRECTPTSNAECECISGLHCSGVGCESCQPDCKEGQESTVK
GCRDCSFGTFNDQKQGSCRPWTNCSLNGLVVLVNGTSKTDVLCGPTRTDAPPATTSGTVP
AFLVKTDKNQQLVTFTLALVMAVGFFVLLTFSWFYFAIRNKKKLSFLLQQTLKKPVQIAQ
EEDACSCGFPEEEQGEREIIKFQSELHLELILKDSKQ
Download sequence
Identical sequences K7E1Y0
ENSMODP00000038842 ENSMODP00000039781 XP_001365761.1.35504 XP_007493108.1.35504 XP_007493109.1.35504 ENSMODP00000038842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]