SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038882 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038882
Domain Number 1 Region: 120-202
Classification Level Classification E-value
Superfamily GTF2I-like repeat 2.88e-29
Family GTF2I-like repeat 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038882   Gene: ENSMODG00000028938   Transcript: ENSMODT00000041988
Sequence length 377
Comment pep:novel chromosome:BROADO5:Un:51514045:51544198:-1 gene:ENSMODG00000028938 transcript:ENSMODT00000041988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMGKHFDGPTNASGPDRWSAIFPRKDEIITSLVSALDSMCSALSKLNAEVACVAVHDE
SAFVVGTEKGRIFLNSRKELQTDFLRFCRGHQRKEPEMEVPRKVRECHRNTQRVSPDQGS
DVYLLRKMVEEVFDVLYSEALGKASVVPVPYEKLLKDPGSLAVQGLPDGLGFRKPSDYDL
KALMAILEQSHRIRFKLKRPPDENGRDLKSSVELNCVSLLPKGPRDSGLNAQGPKPTSQD
PSASSAAMTNFLYNVSLPNHVTMDLKQEGPTSLPTATDLLLARPAGEPKTPGAQDFPDCC
GQKSAGSGGPLIQNVHASKRILFSIVHDKTEKWDSFIKETEDINTLRECVQILFNSRYGE
WESQCHYANAGPCFAYH
Download sequence
Identical sequences K7DZD1
ENSMODP00000038882 ENSMODP00000038882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]